IFIARLINEITEM-PAYTADVICEISSENTBYEDI SAP table Field - Indicator: Send Payment Advices by EDI values










PAYTADVICEISSENTBYEDI is a standard field within SAP Table view IFIARLINEITEM that stores Indicator: Send Payment Advices by EDI information.

Below is the list of attribute values for the PAYTADVICEISSENTBYEDI field including its length, data type, description text, associated data element, search help etc... You could also view this information on your SAP system if you enter the table name IFIARLINEITEM or data type PAYTADVICEISSENTBYEDI into the relevant SAP transactions such as SE11 or SE80 etc.

Also check out the example ABAP code to select data contained in this field along with useful hints, tips and screen shots specific to this SAP table field.


Summery for field IFIARLINEITEM-PAYTADVICEISSENTBYEDI

SAP paytadviceissentbyedi-IFIARLINEITEM field is a none Key Field of table IFIARLINEITEM that it stores Indicator: Send Payment Advices by EDI


Attributes of IFIARLINEITEM SAP Table field PAYTADVICEISSENTBYEDI

Main Table view: IFIARLINEITEM
Short Description: Indicator: Send Payment Advices by EDI.
Position of field in table:0131
Keyfield:No
Application Class:
Mandatory:No
Check table:
Used for foreign key relationship so that entries are restricted to those that appear within the primary key of the check table.
Memory ID:
Data type CHAR
Field Length 000001
Number of Decimals 000000
Internal type(i.e. C,I,N):C
Internal Length(in Bytes):000002
Reference table:
Can field have NULL value?:No
Data Element / Component Type:XEDIP
Domain name:XFELD
Reference field for currency/qty fields:
Origin of Search help:F - Input help with fixed values
The search help functionality for this field is implemented via the assignment of fixed values contained within the Domain (see Domain details for more details).
Search help attached to field:
Is field a table (i.e. nested table):No
Depth for structured types:00
Component Type:Data Element
Is allocated Language Field?:
If a table/structure contains more than 1 language field (i.e. data type LANG) this flag denotes which one is used for the text language


Object Referenced type:
Position of field in database:0000
Check table name of the foreign key:
Cardinality of a relationship:
Short text:
Message for unsuccessful foreign key check:

Example ABAP code to select data from table IFIARLINEITEM field PAYTADVICEISSENTBYEDI

DATA: LD_PAYTADVICEISSENTBYEDI TYPE IFIARLINEITEM-PAYTADVICEISSENTBYEDI.

SELECT single PAYTADVICEISSENTBYEDI
FROM IFIARLINEITEM
INTO LD_PAYTADVICEISSENTBYEDI
WHERE...

Attributes of SAP Data Element

Data element (semantic domain): More details...XEDIP
Language Key: More details...
Activation State of Repository Object: More details...Entry activated or generated in this form
Version of the entry (not used): More details...
Domain name: More details...XFELD
Short Description of Repository Objects: More details...
Length (No. of Characters): More details...
Get/Set parameter ID: More details...
No parameter ID is assigned to this data element so the ABAP statements GET PARAMETER ID and SET PARAMETER ID can't be used to store and retrieve values from memory
Heading: More details...
Flag for writing change documents: More details...No
Change document history is not recorded for this FIELD and no entries will be made in tables CDHDR and CDPOS.
Short Field Label: More details...
Medium Field Label: More details...
Maximum length of heading: More details...
Long Field Label: More details...
Max. length for short field label: More details...
Max. length for medium field label: More details...
Max. length for long field label: More details...
Activation flag: More details...Start of activation or activation successful
Application class for DD objects (not used): More details...
Activation type: More details...
Original Language in Repository objects: More details...
SDIC: Reserve for data elements (not used): More details...
Flag for private DD objects (not used): More details...
Name of a Search Help: More details...
Name of a search help parameter: More details...
Default name for components using the data element: More details...
Data Type in ABAP Dictionary: More details...CHAR
Length (No. of Characters): More details...1
Number of Decimal Places: More details...
Output Length: More details...
Allow lowercase letters or NOT: More details...No
As this is set to No all text stored within a field associated with domain will be converted to uppercase irrespective of case entered by the user.
Field contains negative values: More details...Yes
Basically saves the first position of the field so that a + or -sign can be displayed when output. Only valid for floating point,Quantity, Decimal and Currency data types
Conversion Routine: More details...
Converts the field value between the display and internally stored format. The 5 char ID (i.e. ) associates this field with the underlying ABAP function modules that perform the conversion.
Domain contains fixed values: More details...No
Value table: More details...
Category of Dictionary Type: More details...
Type of Object Referenced: More details...
Not relevant as this field is an Elementary Domain Type rather than a reference type.
DD: Is a generated proxy object: More details...
Force write direction to be LTR: More details...
If this flag is set the field content is always displayed using the left to right writing direction, even if the write direction of the screen/user is right to left. Maybe useful for digit based data such as phone numbers which may be un-readable using RTL direction. See OSS note 1291845
DD: No Filtering of BIDI Formatting Characters: More details...
DD: Flag for Deactivating Input History in Dynpro Field: More details...
ABAP Language Version: More details...

Other SAP tables containing same field/data element

SAP tables containing data element XEDIP

Search for further information about these or an SAP related objects



Comments on this SAP object

What made you want to lookup this SAP object? Please tell us what you were looking for and anything you would like to be included on this page!